PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr006811.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 342aa    MW: 37375.7 Da    PI: 8.6932
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr006811.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC75.26.8e-2476120145
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  d+epgrCrRtDGKkWRCs+++++++k+CErH++rgr+rsrk +e+
  Pbr006811.1  76 DPEPGRCRRTDGKKWRCSKDAYQDSKYCERHMNRGRNRSRKLVES 120
                  79***************************************9986 PP

2QLQ51.92.3e-181448236
          QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36
                  FT aQ++++++Q+l++KyL a++PvP+eLl++i+
  Pbr006811.1 14 LFTVAQWAEMEHQALIFKYLKAGVPVPSELLAPIR 48
                 6********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.5E-91349IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.4981449IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-121548IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.45876120IPR014977WRC domain
PfamPF088792.5E-2077119IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MSGSSVGTGG HAPLFTVAQW AEMEHQALIF KYLKAGVPVP SELLAPIRTS FNLISPNFLP  60
HHPTWGYASY CGKKIDPEPG RCRRTDGKKW RCSKDAYQDS KYCERHMNRG RNRSRKLVES  120
QTASQSLSTV TSDSVIGSSS HGGSFQTMPL HSIGNSGGLC FGGNGSELKM EAIPYGVSNR  180
GARGCNRSGS EEHNFMSEAK RCVQAHSTVD SPWRLMEPQV PLKSELRNSS LWLNNSSQLQ  240
TLQTMESLSG AAAITKQEYV GGEFGLPGSQ KHEQNSLQPL FDEWPKSRDL GFHLNDHRSN  300
TTELSMSNAG ATPKYCTRSD ESPNGTLFSS RTSCRCPPPS P*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009365741.10.0PREDICTED: growth-regulating factor 4-like
TrEMBLD9ZJ000.0D9ZJ00_MALDO; GRF domain class transcription factor
STRINGPOPTR_0001s01480.11e-103(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF47812951
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.15e-41growth-regulating factor 5